(data stored in ACNUC10821 zone)

EMBL: AE017262.GDHA

AE017262.GDHA        Location/Qualifiers
FT   CDS             complement(605570..606946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="LMOf2365_0589"
FT                   /product="glutamate dehydrogenase, NADP-specific"
FT                   /EC_number="1.4.1.4"
FT                   /note="identified by similarity to SP:P00370; match to
FT                   protein family HMM PF00208; match to protein family HMM
FT                   PF02812"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0589"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03371"
FT                   /protein_id="AAT03371.1"
FT                   /translation="MAQTSTIQNDTKAAEEYAARVFETIKLRNPGETEFHQAVEEFLNS
FT                   VIPALAKEPKYEANGILEQLTEPERLISFRVPWVDDSGTVHVNRGYRVQFNSAIGPYKG
FT                   GLRFHPSVTGSIVKFLGFEQIFKNSLTGLPIGGGKGGSDFDPKGKSDSEVMRFCQSFMT
FT                   ELQKHIGPDTDVPAGDIGVGGREIGYLFGQYKRLRGAYDAGTITGKGLSYGGSLARTEA
FT                   TGYGLVYFTVEMLEAAGETIRGKKIVVSGSGNVAIYAIEKAHELGAKVVACSDSAGFVY
FT                   DKEGIKVETVKQLKEVERKRISEYTTIHPSAEYYAGGDVWSVPCDIALPCATQNEINAD
FT                   QARALVKNGVIAVAEGANMPSTLDAVDIYHENKVLFGPAKAANAGGVAVSALEMAQNST
FT                   RMSWTFQTVDEHLQNIMKDIYKNSSNAASEYGAPGNLVIGANIAGFLKVADTMISQGII
FT                   "
     MAQTSTIQND TKAAEEYAAR VFETIKLRNP GETEFHQAVE EFLNSVIPAL AKEPKYEANG        60
     ILEQLTEPER LISFRVPWVD DSGTVHVNRG YRVQFNSAIG PYKGGLRFHP SVTGSIVKFL       120
     GFEQIFKNSL TGLPIGGGKG GSDFDPKGKS DSEVMRFCQS FMTELQKHIG PDTDVPAGDI       180
     GVGGREIGYL FGQYKRLRGA YDAGTITGKG LSYGGSLART EATGYGLVYF TVEMLEAAGE       240
     TIRGKKIVVS GSGNVAIYAI EKAHELGAKV VACSDSAGFV YDKEGIKVET VKQLKEVERK       300
     RISEYTTIHP SAEYYAGGDV WSVPCDIALP CATQNEINAD QARALVKNGV IAVAEGANMP       360
     STLDAVDIYH ENKVLFGPAK AANAGGVAVS ALEMAQNSTR MSWTFQTVDE HLQNIMKDIY       420
     KNSSNAASEY GAPGNLVIGA NIAGFLKVAD TMISQGII                               458
//

If you have problems or comments...

PBIL Back to PBIL home page