(data stored in ACNUC10821 zone)

EMBL: AE017262.GYRB

AE017262.GYRB        Location/Qualifiers
FT   CDS             6030..7970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LMOf2365_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by similarity to SP:P05652; match to
FT                   protein family HMM PF00204; match to protein family HMM
FT                   PF00986; match to protein family HMM PF01751; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0006"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02796"
FT                   /protein_id="AAT02796.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
     MSEENITNVQ ENASDYNEDQ IQVLEGLEAV RKRPGMYIGS TSQRGLHHLV WEIVDNAIDE        60
     ALAGFCTEIE ITIEADNSIT VRDNGRGIPT GINEKIGRPT VEVIFTVLHA GGKFGGGGYK       120
     VSGGLHGVGA SVVNALSTSL EVYVHREGQK YYQRFERGDV VMDMEEQGET DYRGTIVHFT       180
     PDPQIFTETT EFDFDTLRTR TRELAFLNRG LTISIEDKRE EHKVRKDFHY EGGIRSYVEH       240
     LNKAKDVIHE PPIYLEGERD DIMVEISMQY NTGFSSNIIS FANNIHTYEG GTHESGFKTA       300
     LTRVINDYAR RNKLFKDSDD NLSGEDVREG LTAIISIKHP DPQFEGQTKT KLGNSEARSI       360
     TDKLFSEALN KFMMENPDVA KKIVEKGVVA SRARLAAKRA REVARKSSGL EISSLPGKLA       420
     DCSSRNPEIS ELYIVEGDSA GGSAKQGRDR LFQAILPIRG KILNVEKARL DRILANEEIR       480
     TIFTAMGTGF GGDFDVSKSR YHKLIIMTDA DVDGAHIRTL LLTLFYRYMR PLLDAGYIYI       540
     AQPPLYQIKH GKQIEYVYSD GQLEDYLASL DGDTKYSIQR YKGLGEMNPE QLWDTTMNPE       600
     HRTLLQVNIK DAIDADETFE MLMGDRVEPR RKFIEDNAQY VKNLDV                      646
//

If you have problems or comments...

PBIL Back to PBIL home page