(data stored in ACNUC10821 zone)

EMBL: AE017262.HISA

AE017262.HISA        Location/Qualifiers
FT   CDS             complement(608810..609532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="LMOf2365_0593"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="identified by similarity to SP:O35006; match to
FT                   protein family HMM PF00977; match to protein family HMM
FT                   TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0593"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03375"
FT                   /db_xref="GOA:Q722Y6"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y6"
FT                   /protein_id="AAT03375.1"
FT                   /translation="MQIFPAIDLKNGQCVRLFQGDFSKKTVVNEDPIAQAKAFATDGAT
FT                   YLHIVDLDGALEGRPINLEIIQRMKKAAKIPVQVGGGIRSMAQVDYYLESGIDRVIIGS
FT                   AALTNPDFLRAAVQKYGAKIVAGIDAKNGFVATRGWLDVSQVSYLDLAKRMEKVGVETI
FT                   IYTDISRDGTLTGPNLEQMANLKEHVKVSLIASGGVSSRADLEALAQLGLYGAIAGKAL
FT                   YNHDISMSDIVEVEQIAY"
     MQIFPAIDLK NGQCVRLFQG DFSKKTVVNE DPIAQAKAFA TDGATYLHIV DLDGALEGRP        60
     INLEIIQRMK KAAKIPVQVG GGIRSMAQVD YYLESGIDRV IIGSAALTNP DFLRAAVQKY       120
     GAKIVAGIDA KNGFVATRGW LDVSQVSYLD LAKRMEKVGV ETIIYTDISR DGTLTGPNLE       180
     QMANLKEHVK VSLIASGGVS SRADLEALAQ LGLYGAIAGK ALYNHDISMS DIVEVEQIAY       240
//

If you have problems or comments...

PBIL Back to PBIL home page