(data stored in ACNUC10821 zone)

EMBL: AE017262.HISB

AE017262.HISB        Location/Qualifiers
FT   CDS             complement(610138..610722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="LMOf2365_0595"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by similarity to SP:O34683; match to
FT                   protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0595"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03377"
FT                   /db_xref="GOA:Q722Y4"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722Y4"
FT                   /protein_id="AAT03377.1"
FT                   /translation="MRTATKTRITAETSIELSINLDSQAESIISTGVGFLDHMLTLFAK
FT                   HSRITLNVKADGDTYIDAHHTVEDIGITLGLCLKEALADKASINRYGSAYVPMDESLGF
FT                   CALDLSGRSYLVFDAELTNPKLGDFDTELVEEFFQAVAFNTEMNLHLRVLYGKNTHHKI
FT                   EALFKAFGRALREAITINPEIKGVNSTKGVL"
     MRTATKTRIT AETSIELSIN LDSQAESIIS TGVGFLDHML TLFAKHSRIT LNVKADGDTY        60
     IDAHHTVEDI GITLGLCLKE ALADKASINR YGSAYVPMDE SLGFCALDLS GRSYLVFDAE       120
     LTNPKLGDFD TELVEEFFQA VAFNTEMNLH LRVLYGKNTH HKIEALFKAF GRALREAITI       180
     NPEIKGVNST KGVL                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page