(data stored in ACNUC10821 zone)

EMBL: AE017262.HISK

AE017262.HISK        Location/Qualifiers
FT   CDS             613974..614801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisK"
FT                   /locus_tag="LMOf2365_0599"
FT                   /product="histidinol-phosphatase"
FT                   /EC_number="3.1.3.15"
FT                   /note="identified by similarity to SP:O34411; match to
FT                   protein family HMM TIGR01856"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0599"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03381"
FT                   /protein_id="AAT03381.1"
FT                   /translation="MKRDGHTHTEFCPHGTHDDVEEMVLKAIELDFDEYSIVEHAPLSS
FT                   EFMKNTAGDKEAVTTASMAMSDFPYYFKKMNHIKKKYASDLLIHIGFEVDYLIGYEDFT
FT                   RDFLNEYGPQTDDGVLSLHFLEGQGGFRSIDFSAEDYNEGIVQFYGGFEQAQLAYLEGV
FT                   KQSIEADLGLFKPRRMGHISLCQKFQQFFGADTSDFSEEVMEKFRVILALVKKRDYELD
FT                   FNTAGLFKPLCGETYPPKKIVTLASELQIPFVYGSDSHGVQDIGRGYSTYCQK"
     MKRDGHTHTE FCPHGTHDDV EEMVLKAIEL DFDEYSIVEH APLSSEFMKN TAGDKEAVTT        60
     ASMAMSDFPY YFKKMNHIKK KYASDLLIHI GFEVDYLIGY EDFTRDFLNE YGPQTDDGVL       120
     SLHFLEGQGG FRSIDFSAED YNEGIVQFYG GFEQAQLAYL EGVKQSIEAD LGLFKPRRMG       180
     HISLCQKFQQ FFGADTSDFS EEVMEKFRVI LALVKKRDYE LDFNTAGLFK PLCGETYPPK       240
     KIVTLASELQ IPFVYGSDSH GVQDIGRGYS TYCQK                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page