(data stored in ACNUC10821 zone)

EMBL: AE017262.HOLB

AE017262.HOLB        Location/Qualifiers
FT   CDS             171698..172690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LMOf2365_0177"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by similarity to SP:P37540; match to
FT                   protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02964"
FT                   /protein_id="AAT02964.1"
FT                   /translation="MGLQDELTVMQPVVMKIFSKSVRENRLSHGYLFEGARGTGKKRTA
FT                   LWLAQSLFCLESTETELTCGKCANCTRIASHNHPDVHLLEPDGASIKIDQVRALKQELS
FT                   KRGMESDQKVVIIYDAEKMTVQSANSLLKFIEEPEGGLLLLFLTTNPGQILPTIQSRLQ
FT                   PVTFKSLTFDSLLASLTAAGISEQKARIYASITGSVEEAKAFEESEWFSEARNVVIKLY
FT                   EGIHHQGTSPLIIIQESWMPLFKEKDKMALGLELLLLLYRDRLHLTLDENYEPICTAQK
FT                   EMLGQDALRKSLSETTGEIEKILAAKSKLDSNMNTQLLMEQLVLEIQGR"
     MGLQDELTVM QPVVMKIFSK SVRENRLSHG YLFEGARGTG KKRTALWLAQ SLFCLESTET        60
     ELTCGKCANC TRIASHNHPD VHLLEPDGAS IKIDQVRALK QELSKRGMES DQKVVIIYDA       120
     EKMTVQSANS LLKFIEEPEG GLLLLFLTTN PGQILPTIQS RLQPVTFKSL TFDSLLASLT       180
     AAGISEQKAR IYASITGSVE EAKAFEESEW FSEARNVVIK LYEGIHHQGT SPLIIIQESW       240
     MPLFKEKDKM ALGLELLLLL YRDRLHLTLD ENYEPICTAQ KEMLGQDALR KSLSETTGEI       300
     EKILAAKSKL DSNMNTQLLM EQLVLEIQGR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page