(data stored in ACNUC10821 zone)

EMBL: AE017262.IAP

AE017262.IAP         Location/Qualifiers
FT   CDS             complement(625556..626989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iap"
FT                   /locus_tag="LMOf2365_0611"
FT                   /product="protein P60"
FT                   /note="identified by similarity to SP:P21171; match to
FT                   protein family HMM PF00877; match to protein family HMM
FT                   PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0611"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03393"
FT                   /protein_id="AAT03393.1"
FT                   /translation="MNMKKATIAATAGIAVTAFAAPTIASASTVVVEAGDTLWGIAQSK
FT                   GTTVDAIKKANNLTTDKIVPGQKLQVNEVAAAEKTEKSVSATWLNVRSGAGVDNSIITS
FT                   IKGGTKVTVESTESNGWNKITYNDGETGFVNGKYLTDKVASTPVAPTQEVKKETTIQQA
FT                   APAAETKTEVKQTTQATTPAPKVAETKETPVVDQNATTHAVKSGDTIWALSVKYGVSVQ
FT                   DIMSWNNLSSSSIYVGQKLAIKQTANTVTPKAEVKKEAPAAEKQAAPVVKENTNTNTNT
FT                   TTEKKETTQQQTAPKAPTEAAKPAPAPSTNTNANKTNTNTNNTNTSTPSKNTNTNTNSN
FT                   TNTNSNTNANQGSSNNNSNSSASAIIAEAQKHLGKAYSWGGNGPTTFDCSGYTKYVFAK
FT                   AGISLPRTSGAQYASTTRISESQAKPGDLVFFDYGSGISHVGIYVGNGQMINAQDNGVK
FT                   YDNIHGSGWGKYLVGFGRV"
     MNMKKATIAA TAGIAVTAFA APTIASASTV VVEAGDTLWG IAQSKGTTVD AIKKANNLTT        60
     DKIVPGQKLQ VNEVAAAEKT EKSVSATWLN VRSGAGVDNS IITSIKGGTK VTVESTESNG       120
     WNKITYNDGE TGFVNGKYLT DKVASTPVAP TQEVKKETTI QQAAPAAETK TEVKQTTQAT       180
     TPAPKVAETK ETPVVDQNAT THAVKSGDTI WALSVKYGVS VQDIMSWNNL SSSSIYVGQK       240
     LAIKQTANTV TPKAEVKKEA PAAEKQAAPV VKENTNTNTN TTTEKKETTQ QQTAPKAPTE       300
     AAKPAPAPST NTNANKTNTN TNNTNTSTPS KNTNTNTNSN TNTNSNTNAN QGSSNNNSNS       360
     SASAIIAEAQ KHLGKAYSWG GNGPTTFDCS GYTKYVFAKA GISLPRTSGA QYASTTRISE       420
     SQAKPGDLVF FDYGSGISHV GIYVGNGQMI NAQDNGVKYD NIHGSGWGKY LVGFGRV          477
//

If you have problems or comments...

PBIL Back to PBIL home page