(data stored in ACNUC10821 zone)

EMBL: AE017262.INLA

AE017262.INLA        Location/Qualifiers
FT   CDS             484412..486814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlA"
FT                   /locus_tag="LMOf2365_0471"
FT                   /product="internalin A"
FT                   /note="identified by similarity to SP:P25146; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF00746; match to protein family HMM PF08191; match to
FT                   protein family HMM TIGR01167; match to protein family HMM
FT                   TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0471"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03255"
FT                   /db_xref="GOA:Q723K6"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR012569"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR024634"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723K6"
FT                   /protein_id="AAT03255.1"
FT                   /translation="MRRKRYVWLKSILVAILVFGSGVWINTSNGTNAQAATITQDTPIN
FT                   QIFTDTALAEKMKTVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDGLEYLNNLTQIN
FT                   FSNNQLTDITPLKDLTKLVDILMNNNQIADITPLANLSNLTGLTLFNNQITDIDPLKNL
FT                   TNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDI
FT                   SVLAKLTNLESLIATNNQISDITPLGILTNLDELSLNGNQLKDIGTLASLTNLTDLDLA
FT                   NNQISNLAPLSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNLKN
FT                   LTYLTLYFNNISDISPVSSLTKLQRLFFYNNKVSDVSSLANLTNINWLSAGHNQISDLT
FT                   PLANLTRITQLGLNDQEWTNPPVNYKVNVSIPNTVKNVTGALIAPATISDGGSYAEPDI
FT                   TWNLPSYTNEVSYTFNQSVTIGKGTTTFSGTVTQPLKAIFNAKFHVDGKETTKEVEAGN
FT                   LLTEPAKPVKEGYTFVGWFDAQTGGTKWNFSTDKMPTNDIDLYAQFSINSYTATFDNDG
FT                   VTTSQTVDYQGLLQEPTAPTKEGYTFKGWYDAKTGGDKWDFATSKMPAKNITLYAQYSA
FT                   NSYTATFDVDGKTTTQAVDYQGLLKEPKTPTKAGYTFKGWYDEKTDGKKWDFATDKMPA
FT                   NDITLYAQFTKNPVAPPTTGGNTPPTTNNGGNTTPPSANIPGSNTSNTSTGNSASTTST
FT                   MNAYDPYNSKEASLPTTGDSDNALYLLIGLLAVGTAVALTKKARASK"
     MRRKRYVWLK SILVAILVFG SGVWINTSNG TNAQAATITQ DTPINQIFTD TALAEKMKTV        60
     LGKTNVTDTV SQTDLDQVTT LQADRLGIKS IDGLEYLNNL TQINFSNNQL TDITPLKDLT       120
     KLVDILMNNN QIADITPLAN LSNLTGLTLF NNQITDIDPL KNLTNLNRLE LSSNTISDIS       180
     ALSGLTSLQQ LSFGNQVTDL KPLANLTTLE RLDISSNKVS DISVLAKLTN LESLIATNNQ       240
     ISDITPLGIL TNLDELSLNG NQLKDIGTLA SLTNLTDLDL ANNQISNLAP LSGLTKLTEL       300
     KLGANQISNI SPLAGLTALT NLELNENQLE DISPISNLKN LTYLTLYFNN ISDISPVSSL       360
     TKLQRLFFYN NKVSDVSSLA NLTNINWLSA GHNQISDLTP LANLTRITQL GLNDQEWTNP       420
     PVNYKVNVSI PNTVKNVTGA LIAPATISDG GSYAEPDITW NLPSYTNEVS YTFNQSVTIG       480
     KGTTTFSGTV TQPLKAIFNA KFHVDGKETT KEVEAGNLLT EPAKPVKEGY TFVGWFDAQT       540
     GGTKWNFSTD KMPTNDIDLY AQFSINSYTA TFDNDGVTTS QTVDYQGLLQ EPTAPTKEGY       600
     TFKGWYDAKT GGDKWDFATS KMPAKNITLY AQYSANSYTA TFDVDGKTTT QAVDYQGLLK       660
     EPKTPTKAGY TFKGWYDEKT DGKKWDFATD KMPANDITLY AQFTKNPVAP PTTGGNTPPT       720
     TNNGGNTTPP SANIPGSNTS NTSTGNSAST TSTMNAYDPY NSKEASLPTT GDSDNALYLL       780
     IGLLAVGTAV ALTKKARASK                                                   800
//

If you have problems or comments...

PBIL Back to PBIL home page