(data stored in ACNUC10821 zone)

EMBL: AE017262.INLF

AE017262.INLF        Location/Qualifiers
FT   CDS             444851..447322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inlF"
FT                   /locus_tag="LMOf2365_0429"
FT                   /product="internalin"
FT                   /note="identified by similarity to GP:2347102; match to
FT                   protein family HMM PF00560; match to protein family HMM
FT                   PF08191; match to protein family HMM TIGR01167; match to
FT                   protein family HMM TIGR02543"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0429"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03213"
FT                   /protein_id="AAT03213.1"
FT                   /translation="MKAKNNFFKQLISIMTVLSLLFMVLGIQGNNEVKAATLATLPAPI
FT                   NQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYL
FT                   NLNGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLAN
FT                   LTKMYSLNLGANHNLSDLSPLSNMTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQI
FT                   EDISPLASLTSLHYFTAYVNQITDITPVANMTRLNSLKIGNNKITDLSPLANLSQLTWL
FT                   EIGTNQISDINAVKDLTKLKMLNVGSNQISDISVLNNLSQLNSLFLNNNQLGNEDMEVI
FT                   GGLTNLTTLFLSQNHITDIRPLASLSKMDSADFANQVIKKPARNFSKTLSVPNNITSID
FT                   GTLVTPKTISNNGTYDAPNVNWSSPSYLPEVRYTFKQDVAVGSTTSSYTGIIIQPLNEP
FT                   VDYNVTFNIDGNTSEVKTVTEEDLIPEPANPTKQGYTFDGWYDAETGGTKWDFTTGQMP
FT                   ANDLMLYAHFSVNSYQVNFDIDGAVMNEAVVYDTLLNEPTAPTKQGYTFDGWYDAETGG
FT                   NKWDFKTMKMPANDVTLYAHFTVSSYQVNFDIDGAVTNEAIVYDTLLNEPATPTKQGYT
FT                   FDGWYDAETGGNKWDFKTMKIPANDVTLYAHFTINNYQANFDIDGSVTNETITYDTLLN
FT                   EPTAPTKQGFLFDGWYDAEVGGTKWDFNTMKMPANDITLYAHFSKETPLIPSPSDESDS
FT                   KPTNGSITINEPSATSMPVQNNNITVTAGENTPELTTAKLPKTGDNNPWQTLFAGILLS
FT                   SSAFYIWRKKA"
     MKAKNNFFKQ LISIMTVLSL LFMVLGIQGN NEVKAATLAT LPAPINQIFP DADLAEGIRA        60
     VLQKASVTDV VTQEELESIT KLVVAGEKVA SIQGIEYLTN LEYLNLNGNQ ITDISPLSNL       120
     VKLTNLYIGT NKITDISALQ NLTNLRELYL NEDNISDISP LANLTKMYSL NLGANHNLSD       180
     LSPLSNMTGL NYLTVTESKV KDVTPIANLT DLYSLSLNYN QIEDISPLAS LTSLHYFTAY       240
     VNQITDITPV ANMTRLNSLK IGNNKITDLS PLANLSQLTW LEIGTNQISD INAVKDLTKL       300
     KMLNVGSNQI SDISVLNNLS QLNSLFLNNN QLGNEDMEVI GGLTNLTTLF LSQNHITDIR       360
     PLASLSKMDS ADFANQVIKK PARNFSKTLS VPNNITSIDG TLVTPKTISN NGTYDAPNVN       420
     WSSPSYLPEV RYTFKQDVAV GSTTSSYTGI IIQPLNEPVD YNVTFNIDGN TSEVKTVTEE       480
     DLIPEPANPT KQGYTFDGWY DAETGGTKWD FTTGQMPAND LMLYAHFSVN SYQVNFDIDG       540
     AVMNEAVVYD TLLNEPTAPT KQGYTFDGWY DAETGGNKWD FKTMKMPAND VTLYAHFTVS       600
     SYQVNFDIDG AVTNEAIVYD TLLNEPATPT KQGYTFDGWY DAETGGNKWD FKTMKIPAND       660
     VTLYAHFTIN NYQANFDIDG SVTNETITYD TLLNEPTAPT KQGFLFDGWY DAEVGGTKWD       720
     FNTMKMPAND ITLYAHFSKE TPLIPSPSDE SDSKPTNGSI TINEPSATSM PVQNNNITVT       780
     AGENTPELTT AKLPKTGDNN PWQTLFAGIL LSSSAFYIWR KKA                         823
//

If you have problems or comments...

PBIL Back to PBIL home page