(data stored in ACNUC10821 zone)

EMBL: AE017262.ISPD

AE017262.ISPD        Location/Qualifiers
FT   CDS             261061..261759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="LMOf2365_0247"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /EC_number="2.7.7.60"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0247"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03034"
FT                   /db_xref="GOA:Q724H7"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H7"
FT                   /protein_id="AAT03034.1"
FT                   /translation="MNYELVFLAAGQGKRMNAQKNKMWLELVGEPIFIHALRPFLADNR
FT                   CSKVIVVSQEEERKHVKELMSQLNVAESRIEIVKGGSERQYSVAAGLERCGTERVVLVH
FT                   DGARPFITLDIIDRLLIGVEQSKAAICAVKVKDTVKRVVKGVVQETVDRENLWQVQTPQ
FT                   AFELPILRKAHQLARKEQFLGTDEASLVERLPCPVAIVQGSYYNIKLTTPEDMPLAKAI
FT                   LGELGGIAND"
     MNYELVFLAA GQGKRMNAQK NKMWLELVGE PIFIHALRPF LADNRCSKVI VVSQEEERKH        60
     VKELMSQLNV AESRIEIVKG GSERQYSVAA GLERCGTERV VLVHDGARPF ITLDIIDRLL       120
     IGVEQSKAAI CAVKVKDTVK RVVKGVVQET VDRENLWQVQ TPQAFELPIL RKAHQLARKE       180
     QFLGTDEASL VERLPCPVAI VQGSYYNIKL TTPEDMPLAK AILGELGGIA ND               232
//

If you have problems or comments...

PBIL Back to PBIL home page