(data stored in ACNUC10821 zone)

EMBL: AE017262.ISPE

AE017262.ISPE        Location/Qualifiers
FT   CDS             199346..200227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="LMOf2365_0201"
FT                   /product="4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
FT                   kinase activity"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0201"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02988"
FT                   /db_xref="GOA:Q724M3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724M3"
FT                   /protein_id="AAT02988.1"
FT                   /translation="MKISITAPAKINLSLDALYKREDGYHEVEMVMTTIDLADRLYLER
FT                   LDEDKIVLDVKAHFIPEDRRNLIYQAALLLKKRFDVKMGVRITIDKHIPVSAGLAGGSS
FT                   DAAAALKGLNVIWELGLSIEELAEISSEIGSDIAFCVYGGTALATGRGEKISALPNIPG
FT                   CWIVLAKPSISVSTPTIYKELQVDNVEHPDTQKMIESIKNGDLDGIFASTGNVLESVTL
FT                   EKNPQVKRIKDRMLAFGAEAALMSGSGPTVFALIKQYSRAKRVYNGLRGFCEEVYMVRP
FT                   WSEGENDTNINN"
     MKISITAPAK INLSLDALYK REDGYHEVEM VMTTIDLADR LYLERLDEDK IVLDVKAHFI        60
     PEDRRNLIYQ AALLLKKRFD VKMGVRITID KHIPVSAGLA GGSSDAAAAL KGLNVIWELG       120
     LSIEELAEIS SEIGSDIAFC VYGGTALATG RGEKISALPN IPGCWIVLAK PSISVSTPTI       180
     YKELQVDNVE HPDTQKMIES IKNGDLDGIF ASTGNVLESV TLEKNPQVKR IKDRMLAFGA       240
     EAALMSGSGP TVFALIKQYS RAKRVYNGLR GFCEEVYMVR PWSEGENDTN INN              293
//

If you have problems or comments...

PBIL Back to PBIL home page