(data stored in ACNUC10821 zone)

EMBL: AE017262.ISPF

AE017262.ISPF        Location/Qualifiers
FT   CDS             261752..262225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="LMOf2365_0248"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF02542;
FT                   match to protein family HMM TIGR00151"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0248"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03035"
FT                   /db_xref="GOA:Q724H6"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724H6"
FT                   /protein_id="AAT03035.1"
FT                   /translation="MIRIGQGYDVHKLAYDRELIVGGIKIPYEKGLLGHSDADVLLHAI
FT                   TDAIIGAIGAGDIGHFFPDTDMAFKDADSAELLEEIWQKVEADGFRLGNLDATIIAEKP
FT                   KMAPYVEQMKLRIAELLHADSAQVNVKATTTEKLGFTGREEGIASLAVVLLEK"
     MIRIGQGYDV HKLAYDRELI VGGIKIPYEK GLLGHSDADV LLHAITDAII GAIGAGDIGH        60
     FFPDTDMAFK DADSAELLEE IWQKVEADGF RLGNLDATII AEKPKMAPYV EQMKLRIAEL       120
     LHADSAQVNV KATTTEKLGF TGREEGIASL AVVLLEK                                157
//

If you have problems or comments...

PBIL Back to PBIL home page