(data stored in ACNUC10821 zone)

EMBL: AE017262.LMAA

AE017262.LMAA        Location/Qualifiers
FT   CDS             134957..135469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /locus_tag="LMOf2365_0136"
FT                   /product="prophage LambdaLm01, antigen A"
FT                   /note="identified by similarity to OMNI:NTL01LM0118; match
FT                   to protein family HMM TIGR02126"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0136"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02924"
FT                   /protein_id="AAT02924.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
     MAFEENLYCD YTPGAAKAVA GKDVILAVFN AAGDKLLAVA GQQGLTVNRS KDSIEITSKD        60
     TVGGWKSKIG GMKEWSIEND GLYVADAESH KELAKYFESD SPVCVKIINQ ASKKGLFGGL       120
     AIVADYSFEA PFDEAMTYSV KLDGMGALVD LTITEGGDQM PGETPVAPAE                  170
//

If you have problems or comments...

PBIL Back to PBIL home page