(data stored in ACNUC10821 zone)

EMBL: AE017262.LMAB

AE017262.LMAB        Location/Qualifiers
FT   CDS             134555..134944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /locus_tag="LMOf2365_0135"
FT                   /product="prophage LambdaLm01, antigen B"
FT                   /note="identified by similarity to OMNI:NTL01LM0117"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0135"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02923"
FT                   /protein_id="AAT02923.1"
FT                   /translation="MKSLSFMRVLEAVRTMLQEKGGLDVSIVMRDQVEMPTTMIEMIDQ
FT                   EEEESQTAWKEKYRFAIHHYTNETDLAGVEMIDTLIQTGFTLPEGYKLIAVRHYGKQNL
FT                   VKENTLIHAKTSFEVSICRELKVKI"
     MKSLSFMRVL EAVRTMLQEK GGLDVSIVMR DQVEMPTTMI EMIDQEEEES QTAWKEKYRF        60
     AIHHYTNETD LAGVEMIDTL IQTGFTLPEG YKLIAVRHYG KQNLVKENTL IHAKTSFEVS       120
     ICRELKVKI                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page