(data stored in ACNUC10821 zone)

EMBL: AE017262.LMAC

AE017262.LMAC        Location/Qualifiers
FT   CDS             133859..134275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lmaC"
FT                   /locus_tag="LMOf2365_0134"
FT                   /product="prophage LambdaLm01, antigen C"
FT                   /note="identified by match to protein family HMM TIGR01637"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0134"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02922"
FT                   /protein_id="AAT02922.1"
FT                   /translation="MQVLVLPENKDINYIKTVQEVKRFFADFERFRMITGLSKKPQLLR
FT                   NGFLEEPQFAPVAFSARHNKEVILEARWLVEKYTEMLNQMDDLYRTILMECYVERKQDV
FT                   AVMMDLPYEIAQFKRIKKRAVLEIATLMGILVRK"
     MQVLVLPENK DINYIKTVQE VKRFFADFER FRMITGLSKK PQLLRNGFLE EPQFAPVAFS        60
     ARHNKEVILE ARWLVEKYTE MLNQMDDLYR TILMECYVER KQDVAVMMDL PYEIAQFKRI       120
     KKRAVLEIAT LMGILVRK                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page