(data stored in ACNUC10821 zone)

EMBL: AE017262.LYSS

AE017262.LYSS        Location/Qualifiers
FT   CDS             240787..242283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="LMOf2365_0240"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0240"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03027"
FT                   /db_xref="GOA:Q724I4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q724I4"
FT                   /protein_id="AAT03027.1"
FT                   /translation="MSNENHEELNDQLIVRREKVDTLREEGIDPFGEKFIRSISPEEIE
FT                   TKFADKSKEELEEAAIEVSVAGRIMTKRVKGKVGFTHIQDRFHQLQIYIRKDAIGEDAY
FT                   AVFKLADLGDIIGIKGTIFRTNTGELSVKATEFTLLSKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITNEESQNRFVMRSKILKYTRDYMDNQGFLEVETPVLHTIAGGAAAKPFITHHN
FT                   ALDMELYLRIALELHLKRLIVGGMDKVYEIGRVFRNEGTSTRHNPEFTMLESYAAYEDY
FT                   EDVMDLVEGLVSTVCKQVNGTTEITYGEYNVDLTPNWRRIHMADAVKEYVGVDFWNVTS
FT                   DEEARELAKKHNVPVTEHMTYGHILNEFFETYVEEKLIQPTFVYGHPVEISPLAKKNKE
FT                   DDRFTDRFELFIVGREHANAFSELNDPIDQRERFEAQMKEREQGNDEAHGMDADFLEAL
FT                   EYGLPPTGGLGIGIDRLVMLLTDAPSIRDILLFPTMKHRD"
     MSNENHEELN DQLIVRREKV DTLREEGIDP FGEKFIRSIS PEEIETKFAD KSKEELEEAA        60
     IEVSVAGRIM TKRVKGKVGF THIQDRFHQL QIYIRKDAIG EDAYAVFKLA DLGDIIGIKG       120
     TIFRTNTGEL SVKATEFTLL SKSLRPLPDK YHGLKDVEQR YRQRYLDLIT NEESQNRFVM       180
     RSKILKYTRD YMDNQGFLEV ETPVLHTIAG GAAAKPFITH HNALDMELYL RIALELHLKR       240
     LIVGGMDKVY EIGRVFRNEG TSTRHNPEFT MLESYAAYED YEDVMDLVEG LVSTVCKQVN       300
     GTTEITYGEY NVDLTPNWRR IHMADAVKEY VGVDFWNVTS DEEARELAKK HNVPVTEHMT       360
     YGHILNEFFE TYVEEKLIQP TFVYGHPVEI SPLAKKNKED DRFTDRFELF IVGREHANAF       420
     SELNDPIDQR ERFEAQMKER EQGNDEAHGM DADFLEALEY GLPPTGGLGI GIDRLVMLLT       480
     DAPSIRDILL FPTMKHRD                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page