(data stored in ACNUC10821 zone)

EMBL: AE017262.METQ

AE017262.METQ        Location/Qualifiers
FT   CDS             complement(324739..325560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="LMOf2365_0305"
FT                   /product="D-methionine ABC transporter,
FT                   D-methionine-binding protein"
FT                   /note="identified by similarity to SP:P28635; match to
FT                   protein family HMM PF03180; match to protein family HMM
FT                   TIGR00363"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0305"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03092"
FT                   /protein_id="AAT03092.1"
FT                   /translation="MRKLTKGLGILLASSLVLGLAACGGGSDDKALSTEKITIGTTAGP
FT                   HQQIAEEVQKLAKKDGLEIKIKTFDDYNTPNTALNDGDLDANNYQTIPFLEQQKKDKGY
FT                   KLDVAFKTVAFPMGIYSNDIKDLKNLKKGDKIAVPNDPSNEYRGLKLFEDAGVIKLKDG
FT                   VEEKATKKDIAENPLDLEIVELEASQIPAQLDEVAAAAINTNFAMGAGLSINKDAIYHE
FT                   PTKDNPYPNVFVVRSANKDDEVVKTLEKYYHSDEVKAFIEKEFNGSVVPAF"
     MRKLTKGLGI LLASSLVLGL AACGGGSDDK ALSTEKITIG TTAGPHQQIA EEVQKLAKKD        60
     GLEIKIKTFD DYNTPNTALN DGDLDANNYQ TIPFLEQQKK DKGYKLDVAF KTVAFPMGIY       120
     SNDIKDLKNL KKGDKIAVPN DPSNEYRGLK LFEDAGVIKL KDGVEEKATK KDIAENPLDL       180
     EIVELEASQI PAQLDEVAAA AINTNFAMGA GLSINKDAIY HEPTKDNPYP NVFVVRSANK       240
     DDEVVKTLEK YYHSDEVKAF IEKEFNGSVV PAF                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page