(data stored in ACNUC10821 zone)

EMBL: AE017262.METX

AE017262.METX        Location/Qualifiers
FT   CDS             complement(641913..643019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="LMOf2365_0623"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by similarity to SP:P45131; match to
FT                   protein family HMM PF00561; match to protein family HMM
FT                   TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0623"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03405"
FT                   /db_xref="GOA:Q722V6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q722V6"
FT                   /protein_id="AAT03405.1"
FT                   /translation="MTLQQKELFQKSPLLLENGETLSPVLVGYETYGTLSASRDNCILL
FT                   EHALTGTAHAAKHFESDAPGWWDDYIGPGKTIDTDKYFLVCTNVFGGCSGTTGPSSINP
FT                   KTGEPFRLQFPGFSIKDIIKVQRELLEQLGVTRIVSVIGGSMGGMQATEWAIDYADITD
FT                   SIINIASPLAAGPDAIGYNLIMRMAILNDPDFNGGNYVGQPEGGLATARMVGMMTYRTS
FT                   ELFSKRFERFTVAESSPAAFSKEHFQIESYLQYQGDTFVERFDANSYLYLTKAIDLFDV
FT                   TAPAKDDLPAFAKIKIPYLLIGITTDQLFRIHDLRRGYELLKEWDVPVTYHEVASEYGH
FT                   DAFLVEKEVPKFEPLIRSFLSNLPVKSI"
     MTLQQKELFQ KSPLLLENGE TLSPVLVGYE TYGTLSASRD NCILLEHALT GTAHAAKHFE        60
     SDAPGWWDDY IGPGKTIDTD KYFLVCTNVF GGCSGTTGPS SINPKTGEPF RLQFPGFSIK       120
     DIIKVQRELL EQLGVTRIVS VIGGSMGGMQ ATEWAIDYAD ITDSIINIAS PLAAGPDAIG       180
     YNLIMRMAIL NDPDFNGGNY VGQPEGGLAT ARMVGMMTYR TSELFSKRFE RFTVAESSPA       240
     AFSKEHFQIE SYLQYQGDTF VERFDANSYL YLTKAIDLFD VTAPAKDDLP AFAKIKIPYL       300
     LIGITTDQLF RIHDLRRGYE LLKEWDVPVT YHEVASEYGH DAFLVEKEVP KFEPLIRSFL       360
     SNLPVKSI                                                                368
//

If you have problems or comments...

PBIL Back to PBIL home page