(data stored in ACNUC10821 zone)

EMBL: AE017262.MFD

AE017262.MFD         Location/Qualifiers
FT   CDS             223056..226595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="LMOf2365_0225"
FT                   /product="transcription-repair coupling factor"
FT                   /note="identified by similarity to SP:P37474; match to
FT                   protein family HMM PF00270; match to protein family HMM
FT                   PF00271; match to protein family HMM PF02559; match to
FT                   protein family HMM PF03461; match to protein family HMM
FT                   PF04851; match to protein family HMM TIGR00580"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0225"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03012"
FT                   /protein_id="AAT03012.1"
FT                   /translation="MKGLQQLIYEQKDIRAVLNALDEKEKAQLVTGLTGSSRALFASVV
FT                   EGASKRPVVFVTHNLYHAQKLYDDLLSLMDVDRLFLYPADELISSELSISSPELRGQRV
FT                   EALDFLLSGKPGIVIVPVAGLRKMLPPVSLWKHFNISIVEGEEIDPDVLRQKLVTMGYT
FT                   MSGMVNTPGEFSVRGGIIDIYPITEEFPIRIELFDTEVDSLRFFDVETQRSTTRVEEFR
FT                   LLPATEIILDQSYYPDIVKRLEKKMTHTLNELKENEDKQALVENLEEDLEMLRSGVKPD
FT                   MFFKYIGLAYPDPASLFDYFPKNTAILLDEFGRILETEESLEREEAEWQTETLSRMETV
FT                   RDVQVSHSFKKLLEANHSPKIYLSLFQKQMASMRVSKTTNIVYKQMQQFHGQMNVLKTE
FT                   LESWHKNNYAVVILAPNLERAEKMQQTLTDYDMESTILKKESDVPKYGMVQFVIGTFQN
FT                   GFELPLAKVAIISETELFNKKIKKVKKRQKLSNAERIQSYSELKVGDYVVHVNHGIARY
FT                   VGMETLDINGVHKDYLLLVYQGEDKLFIPVDQLDLVQKYVGAEGKSPRLNKLGGAEWKR
FT                   VKKKVQASVQDIADDLIKLYAEREAEKGYAFSADDEMQREFEEAFPYQETEDQLRSISE
FT                   IKKDMERPRPMDRLLVGDVGYGKTEVALRAAFKAIMDGKQVAFLVPTTILAQQHFETMK
FT                   ERFQGFPIEIGLLSRFRTKKQQTETLKGMKNGTVDVVVGTHRLLSKDVEYQDLGLLIVD
FT                   EEQRFGVTHKEKIKQMRSKIDVLTLTATPIPRTLHMSMLGVRDLSVIETPPANRFPVQT
FT                   YVAEQNNVLVREAIERELARDGQVYYLYNRVESITQKADEISAMVPDARVATAHGQMGE
FT                   SELESVILSFLEGEFDVLVTTTIIETGVDIPNVNTLFVQDADRMGLSQLYQLRGRVGRW
FT                   NRIAYAYFMYQKDKILREEAEKRLSAIKEFTELGSGFKIAMRDLSIRGAGNILGAQQHG
FT                   FIDSVGFDLYSQMLKEAIEAKKPKEEQKQIVPVEIDIQADAYIPEYYITDGRQKIEMYK
FT                   RFRNIETLSELEDLQSDMIDRFGEYPEEVEYLFTMTELKVHALEVGIESVKQEQNKITM
FT                   LFSESGTAGIRGDIVMQIIGEFGRMVGVGMEGTQLKITINVQNKPLKEWLYQVKSLAEK
FT                   LRGAMKERASAEN"
     MKGLQQLIYE QKDIRAVLNA LDEKEKAQLV TGLTGSSRAL FASVVEGASK RPVVFVTHNL        60
     YHAQKLYDDL LSLMDVDRLF LYPADELISS ELSISSPELR GQRVEALDFL LSGKPGIVIV       120
     PVAGLRKMLP PVSLWKHFNI SIVEGEEIDP DVLRQKLVTM GYTMSGMVNT PGEFSVRGGI       180
     IDIYPITEEF PIRIELFDTE VDSLRFFDVE TQRSTTRVEE FRLLPATEII LDQSYYPDIV       240
     KRLEKKMTHT LNELKENEDK QALVENLEED LEMLRSGVKP DMFFKYIGLA YPDPASLFDY       300
     FPKNTAILLD EFGRILETEE SLEREEAEWQ TETLSRMETV RDVQVSHSFK KLLEANHSPK       360
     IYLSLFQKQM ASMRVSKTTN IVYKQMQQFH GQMNVLKTEL ESWHKNNYAV VILAPNLERA       420
     EKMQQTLTDY DMESTILKKE SDVPKYGMVQ FVIGTFQNGF ELPLAKVAII SETELFNKKI       480
     KKVKKRQKLS NAERIQSYSE LKVGDYVVHV NHGIARYVGM ETLDINGVHK DYLLLVYQGE       540
     DKLFIPVDQL DLVQKYVGAE GKSPRLNKLG GAEWKRVKKK VQASVQDIAD DLIKLYAERE       600
     AEKGYAFSAD DEMQREFEEA FPYQETEDQL RSISEIKKDM ERPRPMDRLL VGDVGYGKTE       660
     VALRAAFKAI MDGKQVAFLV PTTILAQQHF ETMKERFQGF PIEIGLLSRF RTKKQQTETL       720
     KGMKNGTVDV VVGTHRLLSK DVEYQDLGLL IVDEEQRFGV THKEKIKQMR SKIDVLTLTA       780
     TPIPRTLHMS MLGVRDLSVI ETPPANRFPV QTYVAEQNNV LVREAIEREL ARDGQVYYLY       840
     NRVESITQKA DEISAMVPDA RVATAHGQMG ESELESVILS FLEGEFDVLV TTTIIETGVD       900
     IPNVNTLFVQ DADRMGLSQL YQLRGRVGRW NRIAYAYFMY QKDKILREEA EKRLSAIKEF       960
     TELGSGFKIA MRDLSIRGAG NILGAQQHGF IDSVGFDLYS QMLKEAIEAK KPKEEQKQIV      1020
     PVEIDIQADA YIPEYYITDG RQKIEMYKRF RNIETLSELE DLQSDMIDRF GEYPEEVEYL      1080
     FTMTELKVHA LEVGIESVKQ EQNKITMLFS ESGTAGIRGD IVMQIIGEFG RMVGVGMEGT      1140
     QLKITINVQN KPLKEWLYQV KSLAEKLRGA MKERASAEN                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page