(data stored in ACNUC10821 zone)

EMBL: AE017262.MMSA

AE017262.MMSA        Location/Qualifiers
FT   CDS             416188..417654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="LMOf2365_0395"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="identified by similarity to SP:P42412; match to
FT                   protein family HMM PF00171; match to protein family HMM
FT                   TIGR01722"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0395"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03180"
FT                   /db_xref="GOA:Q723T1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR023510"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q723T1"
FT                   /protein_id="AAT03180.1"
FT                   /translation="MADVRKLKNYINGEWVESRADKYEDVINPATGEVLCQVPISTRAE
FT                   LDQAAVIAEQAFEKWSQVAVPRRARVLFSFQQLLIQHKEKLARLITLENGKNLSEARGE
FT                   VQRGIENVEFAAGAPTLMMGDSLASIATDVEAANYRYPVGVVGGIAPFNFPMMVPCWMF
FT                   PMAIALGNSFILKPSERTPLLMEKLVELFSEAGLPKGVFNVVYGAHDVVNGILENEIIK
FT                   AVSFVGSKPVGEYVYKTGSANLKRVQALTGAKNHTIVLNDADLEDTVTNVISAAFGSAG
FT                   ERCMACAVVTVEEGIADEFLAALRTAAQNVKIGNGLDDGVFLGPVIREENQKRTIAYIE
FT                   KGLEEGAKLTVDGRETGLSEGHFVGPTILEDVTTDMTIWKDEIFAPVLSVIRVKNLQEA
FT                   VRVANQSEFANGACIFTNNAKAIRYFREKIDAGMLGVNLGVPAPMAFFPFSGWKSSFYG
FT                   TLHANGKDSVDFYTHKKVVTARYSLKGYEE"
     MADVRKLKNY INGEWVESRA DKYEDVINPA TGEVLCQVPI STRAELDQAA VIAEQAFEKW        60
     SQVAVPRRAR VLFSFQQLLI QHKEKLARLI TLENGKNLSE ARGEVQRGIE NVEFAAGAPT       120
     LMMGDSLASI ATDVEAANYR YPVGVVGGIA PFNFPMMVPC WMFPMAIALG NSFILKPSER       180
     TPLLMEKLVE LFSEAGLPKG VFNVVYGAHD VVNGILENEI IKAVSFVGSK PVGEYVYKTG       240
     SANLKRVQAL TGAKNHTIVL NDADLEDTVT NVISAAFGSA GERCMACAVV TVEEGIADEF       300
     LAALRTAAQN VKIGNGLDDG VFLGPVIREE NQKRTIAYIE KGLEEGAKLT VDGRETGLSE       360
     GHFVGPTILE DVTTDMTIWK DEIFAPVLSV IRVKNLQEAV RVANQSEFAN GACIFTNNAK       420
     AIRYFREKID AGMLGVNLGV PAPMAFFPFS GWKSSFYGTL HANGKDSVDF YTHKKVVTAR       480
     YSLKGYEE                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page