(data stored in ACNUC10821 zone)

EMBL: AE017262.MOTA

AE017262.MOTA        Location/Qualifiers
FT   CDS             734145..734996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="LMOf2365_0721"
FT                   /product="chemotaxis protein MotA"
FT                   /note="identified by similarity to SP:P28611; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0721"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03502"
FT                   /protein_id="AAT03502.1"
FT                   /translation="MEITTIIGLVLAVIVIAGSFMIQNISLAMLFSAEALIVIILGTIT
FT                   AVMMAHPWSDVKVVPKLFKILFTKEKMPDKVDVLVQYKEYADEIRRSGVLALEDSVDEI
FT                   EDPFMKRGMRLVVDGQSSPEFLRDVLEEEVASMEERHAAYAKIFASAGAYAPTLGVLGA
FT                   AMGLIHAMGEMSNPDKLSEAIAAAFVCTIFGIFTGYVLWTPFANKLKVKSQKEVHLRYM
FT                   MIEGVVALQERNAPRVVEERLLSFLSPKEKDVLRNGKGKKTREVEEIERGQASQETAGG
FT                   TR"
     MEITTIIGLV LAVIVIAGSF MIQNISLAML FSAEALIVII LGTITAVMMA HPWSDVKVVP        60
     KLFKILFTKE KMPDKVDVLV QYKEYADEIR RSGVLALEDS VDEIEDPFMK RGMRLVVDGQ       120
     SSPEFLRDVL EEEVASMEER HAAYAKIFAS AGAYAPTLGV LGAAMGLIHA MGEMSNPDKL       180
     SEAIAAAFVC TIFGIFTGYV LWTPFANKLK VKSQKEVHLR YMMIEGVVAL QERNAPRVVE       240
     ERLLSFLSPK EKDVLRNGKG KKTREVEEIE RGQASQETAG GTR                         283
//

If you have problems or comments...

PBIL Back to PBIL home page