(data stored in ACNUC10821 zone)

EMBL: AE017262.MPL

AE017262.MPL         Location/Qualifiers
FT   CDS             213099..214631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpl"
FT                   /locus_tag="LMOf2365_0214"
FT                   /product="zinc metallopeptidase"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to SP:P34025; match to
FT                   protein family HMM PF01447; match to protein family HMM
FT                   PF02868; match to protein family HMM PF03413; match to
FT                   protein family HMM PF07504"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0214"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03001"
FT                   /protein_id="AAT03001.1"
FT                   /translation="MKSKLICIIMVIAFQAHFNMAVKADSVGEERLRNNIQAKRNPADL
FT                   KTLPDSCEAKDFYKNFKILDMTKDKLGVTHYTLALSSDGYLTDNDEIKVHVTPDNKITF
FT                   INGDLQQGQLRITNQIKITEKNAIEKAFEAIGQSEAHVKSYIGNPVKEKEIIINSRTKR
FT                   LVYNIKLIFAEPEVASWIIQVDAETGAILKKQNMLSEVERADTHKDFQALGKGANRLLQ
FT                   RPLHVMKINDLFYLVDRTHKGLIRTFDLNHKTDASFGKVVSNKTNMFTDPEFSSAVDAH
FT                   FYASEVYDYYKNVHQLESLDGKGGEIDSFVHYGLNCNNAFWDGREILYGDGDKKNFKPF
FT                   SCAKTIVGHELTHAVIQYSAGLEYEGQSGALNESFADVFGYFIAPNHWLIGEDVCVRGL
FT                   RDGRIRSIKDPDKYNQAAHMKDYESLPITEEGDWGGVHFNSGIPNKAAYNTITKLGKEK
FT                   TEQLYFRALKYYLTKKAQFTDAKKALQQAAKDLYGEDASKKVAEAWEAVGVN"
     MKSKLICIIM VIAFQAHFNM AVKADSVGEE RLRNNIQAKR NPADLKTLPD SCEAKDFYKN        60
     FKILDMTKDK LGVTHYTLAL SSDGYLTDND EIKVHVTPDN KITFINGDLQ QGQLRITNQI       120
     KITEKNAIEK AFEAIGQSEA HVKSYIGNPV KEKEIIINSR TKRLVYNIKL IFAEPEVASW       180
     IIQVDAETGA ILKKQNMLSE VERADTHKDF QALGKGANRL LQRPLHVMKI NDLFYLVDRT       240
     HKGLIRTFDL NHKTDASFGK VVSNKTNMFT DPEFSSAVDA HFYASEVYDY YKNVHQLESL       300
     DGKGGEIDSF VHYGLNCNNA FWDGREILYG DGDKKNFKPF SCAKTIVGHE LTHAVIQYSA       360
     GLEYEGQSGA LNESFADVFG YFIAPNHWLI GEDVCVRGLR DGRIRSIKDP DKYNQAAHMK       420
     DYESLPITEE GDWGGVHFNS GIPNKAAYNT ITKLGKEKTE QLYFRALKYY LTKKAQFTDA       480
     KKALQQAAKD LYGEDASKKV AEAWEAVGVN                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page