(data stored in ACNUC10821 zone)

EMBL: AE017262.NRDD

AE017262.NRDD        Location/Qualifiers
FT   CDS             318506..320656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="LMOf2365_0299"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="identified by similarity to GP:4098081; match to
FT                   protein family HMM PF01228; match to protein family HMM
FT                   PF03477; match to protein family HMM TIGR02487"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0299"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03086"
FT                   /protein_id="AAT03086.1"
FT                   /translation="MYVEQLNEQMVIKRDGRKANFDLIKIRNAVEASMKAINLEDETFL
FT                   EEILLEVVSELPNKADMTIDEIQHCVENTLMKSTYPDVARAYIEYRHDRDHERENITDM
FT                   HKSVEKLLQKDKTVVNENANKDATVFNTQRDLTAGAVAKSYALKYMLPKHVSNAHLKGE
FT                   IHFHDLDYSPYHAMTNCCLIDIEGMLSKGFTIGNANVESPKSIQTATAQIAQIIANVAS
FT                   SQYGGCSVDRIDEVLSVYARLNFEKHKKDAMEWVVPEKQEGYAAEKTRKDIYDAMQSLE
FT                   YEINTLYTSNGQTPFVTLGFGLGEDWFAREIQKAILKVRIGGVGKDKHTAIFPKLVFSI
FT                   RRGTNLNAEDPNYDIKQLALECSSKRMYPDVLNYDSLVRLTGDFKVPMGCRSFLPAWEN
FT                   ENGEHVNAGRNNLGVVTLNIPRIAIQSGGDKERFWEIFHERMKTVKDALLFRLNRVRQA
FT                   RPENAPILYKYGAFGKRLQDGENVDQLFNKERSTISIGYIGLYEAATVFYGGEWEGDKE
FT                   AKNFTLDILKELKGYADNWKDEYGYWFSVYSTPSESLTDRFNRLDKEKYGVIKDITDKD
FT                   YYQNSFHYDVRKKITPFEKIDFEKDYPEFCSGGFIHYCEYPKMVHNTKALEAVWDYSYD
FT                   RVAYLGTNTPIDKCYECNFEGEFVPTEEGFKCPSCGNTDPEKADVVKRTCGYLGNPMKR
FT                   PMVHGRHVEISNRVKHMENLGE"
     MYVEQLNEQM VIKRDGRKAN FDLIKIRNAV EASMKAINLE DETFLEEILL EVVSELPNKA        60
     DMTIDEIQHC VENTLMKSTY PDVARAYIEY RHDRDHEREN ITDMHKSVEK LLQKDKTVVN       120
     ENANKDATVF NTQRDLTAGA VAKSYALKYM LPKHVSNAHL KGEIHFHDLD YSPYHAMTNC       180
     CLIDIEGMLS KGFTIGNANV ESPKSIQTAT AQIAQIIANV ASSQYGGCSV DRIDEVLSVY       240
     ARLNFEKHKK DAMEWVVPEK QEGYAAEKTR KDIYDAMQSL EYEINTLYTS NGQTPFVTLG       300
     FGLGEDWFAR EIQKAILKVR IGGVGKDKHT AIFPKLVFSI RRGTNLNAED PNYDIKQLAL       360
     ECSSKRMYPD VLNYDSLVRL TGDFKVPMGC RSFLPAWENE NGEHVNAGRN NLGVVTLNIP       420
     RIAIQSGGDK ERFWEIFHER MKTVKDALLF RLNRVRQARP ENAPILYKYG AFGKRLQDGE       480
     NVDQLFNKER STISIGYIGL YEAATVFYGG EWEGDKEAKN FTLDILKELK GYADNWKDEY       540
     GYWFSVYSTP SESLTDRFNR LDKEKYGVIK DITDKDYYQN SFHYDVRKKI TPFEKIDFEK       600
     DYPEFCSGGF IHYCEYPKMV HNTKALEAVW DYSYDRVAYL GTNTPIDKCY ECNFEGEFVP       660
     TEEGFKCPSC GNTDPEKADV VKRTCGYLGN PMKRPMVHGR HVEISNRVKH MENLGE           716
//

If you have problems or comments...

PBIL Back to PBIL home page