(data stored in ACNUC10821 zone)

EMBL: AE017262.NRDG

AE017262.NRDG        Location/Qualifiers
FT   CDS             320649..321200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="LMOf2365_0300"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /note="identified by similarity to GP:4098082; match to
FT                   protein family HMM TIGR02491"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0300"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03087"
FT                   /protein_id="AAT03087.1"
FT                   /translation="MNNPKPCEWKSNELSRGYIADYKAFNFVDGEGVRCSLYVSGCPFH
FT                   CEGCYNKAAQSFKYGKPYTKELEDDILKDIGHESVQGLTLLGGEPFLNTATCLSVVKRI
FT                   RATYGETKDIWSWTGYTWDEMMQETADKLELLSLIDVLVDGRFEQKLFDPNLAFRGSSN
FT                   QRIIDVQKSLAAGEVVLYEL"
     MNNPKPCEWK SNELSRGYIA DYKAFNFVDG EGVRCSLYVS GCPFHCEGCY NKAAQSFKYG        60
     KPYTKELEDD ILKDIGHESV QGLTLLGGEP FLNTATCLSV VKRIRATYGE TKDIWSWTGY       120
     TWDEMMQETA DKLELLSLID VLVDGRFEQK LFDPNLAFRG SSNQRIIDVQ KSLAAGEVVL       180
     YEL                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page