(data stored in ACNUC10821 zone)

EMBL: AE017262.NUSG

AE017262.NUSG        Location/Qualifiers
FT   CDS             269105..269638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LMOf2365_0258"
FT                   /product="transcription antitermination factor NusG"
FT                   /note="identified by similarity to SP:Q06795; match to
FT                   protein family HMM PF00467; match to protein family HMM
FT                   PF02357; match to protein family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0258"
FT                   /db_xref="EnsemblGenomes-Tr:AAT03045"
FT                   /protein_id="AAT03045.1"
FT                   /translation="MEKNWYVVHTYSGYENKVKANLEKRVESMGMSDKIFRVIVPEEEE
FT                   TEVKNGKTKTIKRKVFPGYVLVEIVMTDDSWYVVRNTPGVTGFVGSAGSGSKPTPLLPE
FT                   EADRILKSMGMVEKRAEADFEIGETVMVKEGPFADFSGKVDEMDNDKGKAKVMVNMFGR
FT                   ETPVEVDFNQIEKL"
     MEKNWYVVHT YSGYENKVKA NLEKRVESMG MSDKIFRVIV PEEEETEVKN GKTKTIKRKV        60
     FPGYVLVEIV MTDDSWYVVR NTPGVTGFVG SAGSGSKPTP LLPEEADRIL KSMGMVEKRA       120
     EADFEIGETV MVKEGPFADF SGKVDEMDND KGKAKVMVNM FGRETPVEVD FNQIEKL          177
//

If you have problems or comments...

PBIL Back to PBIL home page