(data stored in ACNUC10821 zone)

EMBL: AE017262.PE103

AE017262.PE103       Location/Qualifiers
FT   CDS             107275..107517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0105"
FT                   /product="ATP synthase F0, C subunit family protein"
FT                   /note="identified by similarity to SP:Q05366; match to
FT                   protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0105"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02893"
FT                   /protein_id="AAT02893.1"
FT                   /translation="MDLVVACSVIGAALAIGLATLGAAIGQGIAVSRATEIIGKNPNAK
FT                   KEVMGGLFLGLLMIVALMLFALAIAVILLWVNPFI"
     MDLVVACSVI GAALAIGLAT LGAAIGQGIA VSRATEIIGK NPNAKKEVMG GLFLGLLMIV        60
     ALMLFALAIA VILLWVNPFI                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page