(data stored in ACNUC10821 zone)

EMBL: AE017262.PE106

AE017262.PE106       Location/Qualifiers
FT   CDS             110050..110919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0108"
FT                   /product="putative ATP synthase F1, gamma subunit"
FT                   /note="identified by match to protein family HMM PF00231"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0108"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02896"
FT                   /protein_id="AAT02896.1"
FT                   /translation="MSSIDQARKTIKALNSTYKIVHVTELATLGKLSALREKAEAAVSY
FT                   YETILKSLRWVRKTMYTSNNQVKEEKNVTAIAITSERGLCGAYNSEVFVEIDQLIESLG
FT                   EQVTINWVVVGEQGHRYLTKLGQNITSYLQFSLENIDLETTTAVTADFIDLIHSEQMDA
FT                   LYVIFTKYLNAVQSEAMCEKIYPEIPEDSNTEEIEVDYVLDFETDDEQVEQLLLENYLC
FT                   GLLYSMFRYSVASEYCMRRIAMKQAKDNIQKQLEEAIFNARKQALQQKTGELLDIISGA
FT                   QTIRKDEE"
     MSSIDQARKT IKALNSTYKI VHVTELATLG KLSALREKAE AAVSYYETIL KSLRWVRKTM        60
     YTSNNQVKEE KNVTAIAITS ERGLCGAYNS EVFVEIDQLI ESLGEQVTIN WVVVGEQGHR       120
     YLTKLGQNIT SYLQFSLENI DLETTTAVTA DFIDLIHSEQ MDALYVIFTK YLNAVQSEAM       180
     CEKIYPEIPE DSNTEEIEVD YVLDFETDDE QVEQLLLENY LCGLLYSMFR YSVASEYCMR       240
     RIAMKQAKDN IQKQLEEAIF NARKQALQQK TGELLDIISG AQTIRKDEE                   289
//

If you have problems or comments...

PBIL Back to PBIL home page