(data stored in ACNUC10821 zone)

EMBL: AE017262.PE108

AE017262.PE108       Location/Qualifiers
FT   CDS             112303..112635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0110"
FT                   /product="putative ATP synthase F1, epsilon subunit"
FT                   /note="identified by match to protein family HMM PF02823"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0110"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02898"
FT                   /protein_id="AAT02898.1"
FT                   /translation="MKLKIVSPMGQFFEGEVEGFVINTKEGQQTVLEEHIDCLSFFDYS
FT                   EISILDAVASDPIFVALGYLHLVQNEANIMAQFASTDAEQAERIFERLNKRKQTESRRS
FT                   DDKRIF"
     MKLKIVSPMG QFFEGEVEGF VINTKEGQQT VLEEHIDCLS FFDYSEISIL DAVASDPIFV        60
     ALGYLHLVQN EANIMAQFAS TDAEQAERIF ERLNKRKQTE SRRSDDKRIF                  110
//

If you have problems or comments...

PBIL Back to PBIL home page