(data stored in ACNUC10821 zone)

EMBL: AE017262.PE109

AE017262.PE109       Location/Qualifiers
FT   CDS             112616..113176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0138"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0111"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02899"
FT                   /protein_id="AAT02899.1"
FT                   /translation="MTSEFFSTLLLIIGLLLGFFLAILLILVGIRRFLCSAEEPLKRIQ
FT                   RYQLWHNRYQLNAEVTSFLIVIGASLSVSLITLQITAIPFQYTVLIFWSSWLFHLLSFW
FT                   KKIRVPKKMKNEMKQLAGFLLITVLYFVGFFAMKSVHFSIIQVADFPGVIQFGIRTYLT
FT                   ICSFFVACGALIVWQRIYVKLLK"
     MTSEFFSTLL LIIGLLLGFF LAILLILVGI RRFLCSAEEP LKRIQRYQLW HNRYQLNAEV        60
     TSFLIVIGAS LSVSLITLQI TAIPFQYTVL IFWSSWLFHL LSFWKKIRVP KKMKNEMKQL       120
     AGFLLITVLY FVGFFAMKSV HFSIIQVADF PGVIQFGIRT YLTICSFFVA CGALIVWQRI       180
     YVKLLK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page