(data stored in ACNUC10821 zone)

EMBL: AE017262.PE110

AE017262.PE110       Location/Qualifiers
FT   CDS             113351..113983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0140"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0112"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02900"
FT                   /protein_id="AAT02900.1"
FT                   /translation="MTFLEFHQLVKEDLLIYSWIIKNFHLTRQKLMAGGEITMNREQVI
FT                   VMEKGLLVQVNEEGKDDLYRVFIDQRIIFTTKGDITLTALEDTSYSIIRAEELIGKLEG
FT                   QHLLPTFFLEIAEDFEKGLDWQRTLISVDPAERAEMILAKIIERYQINSENKPEFPRWL
FT                   RINVLARFAKCSVSTMSSVVNELVNEGDLNIKGTPWLLTRPYQATCA"
     MTFLEFHQLV KEDLLIYSWI IKNFHLTRQK LMAGGEITMN REQVIVMEKG LLVQVNEEGK        60
     DDLYRVFIDQ RIIFTTKGDI TLTALEDTSY SIIRAEELIG KLEGQHLLPT FFLEIAEDFE       120
     KGLDWQRTLI SVDPAERAEM ILAKIIERYQ INSENKPEFP RWLRINVLAR FAKCSVSTMS       180
     SVVNELVNEG DLNIKGTPWL LTRPYQATCA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page