(data stored in ACNUC10821 zone)

EMBL: AE017262.PE113

AE017262.PE113       Location/Qualifiers
FT   CDS             116098..117009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0115"
FT                   /product="PTS system, mannose/fructose/sorbose family, IID
FT                   component"
FT                   /note="identified by similarity to SP:P08188; match to
FT                   protein family HMM PF03613; match to protein family HMM
FT                   TIGR00828"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0115"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02903"
FT                   /protein_id="AAT02903.1"
FT                   /translation="MAEKIELSKRDRLRVAWRSTFIQGSWNYERMQNGGWAFSMIPAIK
FT                   KLYKTKEDRSQALKRHLEFFNTHPYIASPILGVTLALEEERANGAEVDDVAIQGVKVGM
FT                   MGPLAGVGDPVFWFTIRPMLGALGASLALSGNILGPILFFVAWNVIRWGFMWYTQEFGY
FT                   KAGSKITDDLSGGLLQDITKGASILGMFVLAALVQRWVNIQFAPIISKVKLDEGAYIDW
FT                   SHLPQGAQGIKTALEQQQAGLALSEIKVTTLQNNLDNLIPGLAAVALTFLCMWLLKKKI
FT                   SPIIIILGLFVVGIVGHLIGLL"
     MAEKIELSKR DRLRVAWRST FIQGSWNYER MQNGGWAFSM IPAIKKLYKT KEDRSQALKR        60
     HLEFFNTHPY IASPILGVTL ALEEERANGA EVDDVAIQGV KVGMMGPLAG VGDPVFWFTI       120
     RPMLGALGAS LALSGNILGP ILFFVAWNVI RWGFMWYTQE FGYKAGSKIT DDLSGGLLQD       180
     ITKGASILGM FVLAALVQRW VNIQFAPIIS KVKLDEGAYI DWSHLPQGAQ GIKTALEQQQ       240
     AGLALSEIKV TTLQNNLDNL IPGLAAVALT FLCMWLLKKK ISPIIIILGL FVVGIVGHLI       300
     GLL                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page