(data stored in ACNUC10821 zone)

EMBL: AE017262.PE114

AE017262.PE114       Location/Qualifiers
FT   CDS             117136..117525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GP:16412565; match to
FT                   protein family HMM PF06115"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02904"
FT                   /protein_id="AAT02904.1"
FT                   /translation="MVQSINTKVDLTIDATAYTGLTDYGKIMIGDKGFEFFNSRDVRKF
FT                   VQIPWEEVDQVIVSVMLKGKWIPRYAIKTKRNGTYTFASKRPKEVLRKIRVYVDPANMV
FT                   SSLSFFDVMKRSFRSIFSKKKNKNK"
     MVQSINTKVD LTIDATAYTG LTDYGKIMIG DKGFEFFNSR DVRKFVQIPW EEVDQVIVSV        60
     MLKGKWIPRY AIKTKRNGTY TFASKRPKEV LRKIRVYVDP ANMVSSLSFF DVMKRSFRSI       120
     FSKKKNKNK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page