(data stored in ACNUC10821 zone)

EMBL: AE017262.PE116

AE017262.PE116       Location/Qualifiers
FT   CDS             complement(118038..119555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0118"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0118"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02906"
FT                   /protein_id="AAT02906.1"
FT                   /translation="MRPTNVYTPEDIYLKDRTGFNNGNLAYQYSIYRALWNDDVEIHAD
FT                   GLSSNPNLAEKINENYDLYVMPLADAFRDDFRPVLRNYTQLIRKLKIPVIVTGVGLRAN
FT                   YEPQLDEGFSFDEDVTNFVKAVLEKSAQIGVRGQITADYLKKLGFNAELDFRVIGCPSL
FT                   YTFGREIKIRDFHLTDQSTIAINASPTSSEIAINFLNNMITTYKDYHFIPQHLDEFHLM
FT                   YAGGPDISSDINGYPTNIQHKYYQEGRVKYFTSMPSWFDFVKKVDFSIGSRLHGNVIPT
FT                   IVGTPNISFVQDARMRELASYHALPHVTIDELEKTNNLQELLTKVDLKSAEKVQARNFD
FT                   NYIDFLDTNGLNHIYKYDKNRKSAPMDELINSITFPTSPDPISILNPQEMLNRVKISTN
FT                   LLKERHDFSTRYRVNLVNNQLTQLKKTTSEQNKKYQQKITETQEKNQQLEKQLTDTKQK
FT                   LQLTINKNHELTNKIRHYQGTLNRKSVKTTLKVANSLANLKKKVSRS"
     MRPTNVYTPE DIYLKDRTGF NNGNLAYQYS IYRALWNDDV EIHADGLSSN PNLAEKINEN        60
     YDLYVMPLAD AFRDDFRPVL RNYTQLIRKL KIPVIVTGVG LRANYEPQLD EGFSFDEDVT       120
     NFVKAVLEKS AQIGVRGQIT ADYLKKLGFN AELDFRVIGC PSLYTFGREI KIRDFHLTDQ       180
     STIAINASPT SSEIAINFLN NMITTYKDYH FIPQHLDEFH LMYAGGPDIS SDINGYPTNI       240
     QHKYYQEGRV KYFTSMPSWF DFVKKVDFSI GSRLHGNVIP TIVGTPNISF VQDARMRELA       300
     SYHALPHVTI DELEKTNNLQ ELLTKVDLKS AEKVQARNFD NYIDFLDTNG LNHIYKYDKN       360
     RKSAPMDELI NSITFPTSPD PISILNPQEM LNRVKISTNL LKERHDFSTR YRVNLVNNQL       420
     TQLKKTTSEQ NKKYQQKITE TQEKNQQLEK QLTDTKQKLQ LTINKNHELT NKIRHYQGTL       480
     NRKSVKTTLK VANSLANLKK KVSRS                                             505
//

If you have problems or comments...

PBIL Back to PBIL home page