(data stored in ACNUC10821 zone)

EMBL: AE017262.PE117

AE017262.PE117       Location/Qualifiers
FT   CDS             complement(119670..119963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0119"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0119"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02907"
FT                   /protein_id="AAT02907.1"
FT                   /translation="MKKLNELSKSDLLLIFQALSDPIRLDIFLCLLKSKEKRFSGTTYN
FT                   ISKSTMSHHIKLLKEAKLINLRKEGTTHIYSVNEALVEEIGYFFDACKHNHK"
     MKKLNELSKS DLLLIFQALS DPIRLDIFLC LLKSKEKRFS GTTYNISKST MSHHIKLLKE        60
     AKLINLRKEG TTHIYSVNEA LVEEIGYFFD ACKHNHK                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page