(data stored in ACNUC10821 zone)

EMBL: AE017262.PE123

AE017262.PE123       Location/Qualifiers
FT   CDS             complement(125069..126850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0125"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0125"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02913"
FT                   /protein_id="AAT02913.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPSKNVTQLFWIAIIFIVSVVVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDVPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLRSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
     MARNKFDIDE ELETAFSAAH LKRILVYVKP YQKSIYITLF VILLANVATM IGPYLTKIVI        60
     DDTIPSKNVT QLFWIAIIFI VSVVVTGLCM RYRIRSITLI GQDILKDMRT AIFGHLQKLP       120
     FSYFDSRPHG KILIRVVNYI NMLSDLLSNG LINLISDILS VIVTLGFMLM IDPVLTLYSL       180
     ALIPVLFVIV MVIKTAQRKA YQVLSNKQSN MNAYIHESIA GIKVTQSFSR EEENFEIFTE       240
     VSNEYRRSWM KAVKIQFLLW PGVQNIAVMT TCLIYFVGIK GYGVDVSTGT LIAFIGYVGN       300
     FWNPVINIGN FYNSLITATT YLERIFETMD VEPDIKDVPN AKKMPPIVGN VDFKDVYFRY       360
     EEGVDILKGI NFHVDAGESI ALVGPTGAGK TTIINLLSRF YNINSGEILV DGENVEEVTL       420
     RSLRSQMGVM LQDTFIFSGT IIENIRYGKL DATEEEIIAA AKVVRAHDFI SGLKDGYYTE       480
     VKERGSTLSA GQRQLISFAR ALLADPKILI LDEATSSIDT QTEILLQEGL ERLLEGRTSF       540
     IIAHRLSTIK NSSRIFYIDN GRIQEAGSHE ELMAQHGYYY NLYQSQFDML QAL              593
//

If you have problems or comments...

PBIL Back to PBIL home page