(data stored in ACNUC10821 zone)

EMBL: AE017262.PE125

AE017262.PE125       Location/Qualifiers
FT   CDS             128728..129561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0127"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311; match to protein
FT                   family HMM PF07883"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0127"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02915"
FT                   /protein_id="AAT02915.1"
FT                   /translation="MLKINTTTFNPQILYIANCYTNEVRVGENHHHDFLEISIICEGNV
FT                   IYDIEGERVKLGKGDMLIFNPGVNHYDITEPGMTNAQLHIGFRNFALEGYTRNTFPFKK
FT                   AFLRKKEEESAILSISKQIIEEKDAEKPGYDLILKAFVMQLIIHVLREATPEQLENNGV
FT                   KLSTDEQQKQILVNEIIHYMEKHHTEDVSLSTLSQTMYISPAYISKVFKEETGESPINY
FT                   LIKIRLTRAEELLKNKDVTVKQAANMVGYNDAYYFSKLFKKYYGFPPSENWRKSS"
     MLKINTTTFN PQILYIANCY TNEVRVGENH HHDFLEISII CEGNVIYDIE GERVKLGKGD        60
     MLIFNPGVNH YDITEPGMTN AQLHIGFRNF ALEGYTRNTF PFKKAFLRKK EEESAILSIS       120
     KQIIEEKDAE KPGYDLILKA FVMQLIIHVL REATPEQLEN NGVKLSTDEQ QKQILVNEII       180
     HYMEKHHTED VSLSTLSQTM YISPAYISKV FKEETGESPI NYLIKIRLTR AEELLKNKDV       240
     TVKQAANMVG YNDAYYFSKL FKKYYGFPPS ENWRKSS                                277
//

If you have problems or comments...

PBIL Back to PBIL home page