(data stored in ACNUC10821 zone)

EMBL: AE017262.PE126

AE017262.PE126       Location/Qualifiers
FT   CDS             129704..130711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0128"
FT                   /product="lipase"
FT                   /note="identified by similarity to GP:2853612; match to
FT                   protein family HMM PF07859"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0128"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02916"
FT                   /protein_id="AAT02916.1"
FT                   /translation="MDPFLLKDLKQHLGGTNDAIKEAPQEIQMPDFSNLEIATAAALQM
FT                   RATMGSPNIDLSNGVTTEYRVVEGDYGDIPVRIYRHEEATKPVPAFIFYHGGGFVGGTP
FT                   AVVENFCKGIAEKLPAVVINVDYHLAPEFPAPAAPKDCYRALEWVVEQSDELGIDASKI
FT                   GVSGDSAGGTLAAAVSYMDYEAETNYVGFQALLYPALTLVDEDNDKYQWDISKFGASEE
FT                   TLPLVAPGIIGMNSSGELLRTAYVRDENPASPIYSPLSAVDKSIYPPTLIASAEFDALR
FT                   AFADIFAKELRASGVQTKVIVYQGMCHAFIDKYGIFPQAEDVADEIVQMMKEIF"
     MDPFLLKDLK QHLGGTNDAI KEAPQEIQMP DFSNLEIATA AALQMRATMG SPNIDLSNGV        60
     TTEYRVVEGD YGDIPVRIYR HEEATKPVPA FIFYHGGGFV GGTPAVVENF CKGIAEKLPA       120
     VVINVDYHLA PEFPAPAAPK DCYRALEWVV EQSDELGIDA SKIGVSGDSA GGTLAAAVSY       180
     MDYEAETNYV GFQALLYPAL TLVDEDNDKY QWDISKFGAS EETLPLVAPG IIGMNSSGEL       240
     LRTAYVRDEN PASPIYSPLS AVDKSIYPPT LIASAEFDAL RAFADIFAKE LRASGVQTKV       300
     IVYQGMCHAF IDKYGIFPQA EDVADEIVQM MKEIF                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page