(data stored in ACNUC10821 zone)

EMBL: AE017262.PE128

AE017262.PE128       Location/Qualifiers
FT   CDS             complement(131495..132190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0157"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0130"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02918"
FT                   /protein_id="AAT02918.1"
FT                   /translation="MFHTIDFSDIFSSDYSNKISFKKGEIIHSYRDYEEKTPQIGAILE
FT                   GTAVLEGPTNEGRWMINALIGQHSLFGMESLLETKTAPELTEYRVRALENGTVLFIDRE
FT                   FLLNYLYANPQFFHLILDEVIVRYLFTSKNYKNINQAPIVKVTRILVEIIELLHLHQTE
FT                   GAIELPVYVTQTFLADYCRSSRARVTEVLEELRESGLLLSKKPITISSHENLLNQIDSF
FT                   QTGNGLLTR"
     MFHTIDFSDI FSSDYSNKIS FKKGEIIHSY RDYEEKTPQI GAILEGTAVL EGPTNEGRWM        60
     INALIGQHSL FGMESLLETK TAPELTEYRV RALENGTVLF IDREFLLNYL YANPQFFHLI       120
     LDEVIVRYLF TSKNYKNINQ APIVKVTRIL VEIIELLHLH QTEGAIELPV YVTQTFLADY       180
     CRSSRARVTE VLEELRESGL LLSKKPITIS SHENLLNQID SFQTGNGLLT R                231
//

If you have problems or comments...

PBIL Back to PBIL home page