(data stored in ACNUC10821 zone)

EMBL: AE017262.PE129

AE017262.PE129       Location/Qualifiers
FT   CDS             complement(132409..132870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06114"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0131"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02919"
FT                   /protein_id="AAT02919.1"
FT                   /translation="MILLYEKLVNKYQDEVTIREEKMPYKLPGLYLNGTIFISKDQSSI
FT                   EKGCVLVEELMHYKYTVGNITKQETIMDKKQEIFARRKGYEELIPLDDIIACFYLGLRE
FT                   YFEVAEFLEVTEEFLRHTVTHYAEKYGPMYDYGGYFINFGNSIDVYKKF"
     MILLYEKLVN KYQDEVTIRE EKMPYKLPGL YLNGTIFISK DQSSIEKGCV LVEELMHYKY        60
     TVGNITKQET IMDKKQEIFA RRKGYEELIP LDDIIACFYL GLREYFEVAE FLEVTEEFLR       120
     HTVTHYAEKY GPMYDYGGYF INFGNSIDVY KKF                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page