(data stored in ACNUC10821 zone)

EMBL: AE017262.PE13

AE017262.PE13        Location/Qualifiers
FT   CDS             14803..15873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0013"
FT                   /product="phosphomevalonate kinase"
FT                   /EC_number="2.7.4.2"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR01220"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0013"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02803"
FT                   /protein_id="AAT02803.1"
FT                   /translation="MKNKLQVKIPGKLYVAGEYAVVESGHTAILTAVNRYITLTLEDSE
FT                   RNELWIPHYENPVSWPIGGELKPDGEHWTFTAEAINIATTFLKSEGIELTPVKMVIETE
FT                   LIDQSGAKYGLGSSAAATVAVINALMTKFYPEISMLKKFKLAALSHLVVQGNGSCGDIA
FT                   SCMYGGWIAYTTFDQEWVKHRLAYKSLEWFMKEPWPMLQIETLEEPVPTFSVGWTGTPV
FT                   STGKLVSQIHAFKQEDSKNYQHFLTRNNEIMKQIIQAFHTKDEELLYSSIKENRRILQE
FT                   LGTKAGVNIETSLLKELADSAENMGGAGKSSGSGGGDCGIAFSKTKELAEKLVNEWEKL
FT                   GIKHLPFHTGRVQITE"
     MKNKLQVKIP GKLYVAGEYA VVESGHTAIL TAVNRYITLT LEDSERNELW IPHYENPVSW        60
     PIGGELKPDG EHWTFTAEAI NIATTFLKSE GIELTPVKMV IETELIDQSG AKYGLGSSAA       120
     ATVAVINALM TKFYPEISML KKFKLAALSH LVVQGNGSCG DIASCMYGGW IAYTTFDQEW       180
     VKHRLAYKSL EWFMKEPWPM LQIETLEEPV PTFSVGWTGT PVSTGKLVSQ IHAFKQEDSK       240
     NYQHFLTRNN EIMKQIIQAF HTKDEELLYS SIKENRRILQ ELGTKAGVNI ETSLLKELAD       300
     SAENMGGAGK SSGSGGGDCG IAFSKTKELA EKLVNEWEKL GIKHLPFHTG RVQITE           356
//

If you have problems or comments...

PBIL Back to PBIL home page