(data stored in ACNUC10821 zone)

EMBL: AE017262.PE135

AE017262.PE135       Location/Qualifiers
FT   CDS             135517..135819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0164"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0137"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02925"
FT                   /protein_id="AAT02925.1"
FT                   /translation="MFEVNDTTYILRFNKQKVKTVELTSGISLVAALTANKGILSYQVI
FT                   ETLFVSGLVEEKGLVPVKQKEALEIFDKLVEEQGLISLNVAVIEKLQEDMGFLFR"
     MFEVNDTTYI LRFNKQKVKT VELTSGISLV AALTANKGIL SYQVIETLFV SGLVEEKGLV        60
     PVKQKEALEI FDKLVEEQGL ISLNVAVIEK LQEDMGFLFR                             100
//

If you have problems or comments...

PBIL Back to PBIL home page