(data stored in ACNUC10821 zone)

EMBL: AE017262.PE136

AE017262.PE136       Location/Qualifiers
FT   CDS             135861..136265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0165"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0138"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02926"
FT                   /protein_id="AAT02926.1"
FT                   /translation="MDSEMNHDFDLEKQFAFFVVNFQMSKHDFEELTEVEKNFIMKEWE
FT                   NKVIFESTMLRNAVLNAEQNLNRKRNSRFIDLHKKRQKKADVNYTVNALQAISDNEAKE
FT                   GKAWIDRIYGANGLRRPKNKEERGKVNGGF"
     MDSEMNHDFD LEKQFAFFVV NFQMSKHDFE ELTEVEKNFI MKEWENKVIF ESTMLRNAVL        60
     NAEQNLNRKR NSRFIDLHKK RQKKADVNYT VNALQAISDN EAKEGKAWID RIYGANGLRR       120
     PKNKEERGKV NGGF                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page