(data stored in ACNUC10821 zone)

EMBL: AE017262.PE138

AE017262.PE138       Location/Qualifiers
FT   CDS             138117..138935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0167; match
FT                   to protein family HMM PF06997"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0140"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02928"
FT                   /protein_id="AAT02928.1"
FT                   /translation="MSDLFLELNGKVHSLSETFPGLSVQEVSRQSPQLSMETAEIAGTD
FT                   GVIPGMTQFKPFIFSAKCNLQALDIPDYHLAVREIYEFLFQRDSYYIWSDQMPGIRYEV
FT                   HPKPVDFSRESDRVGLLTIEFDVFKGYAESRGTSLDPMTFEVDLWQMGMNLSNRDDLFY
FT                   IFKENTFRVYNAGSDRVNPLMRHELDIAMTANGTPTIHNLTTGESFEYRKELQKTDVLL
FT                   LNNIYPLVNNRRVGKDTNHGIITLEKGWNDFEIKGVTDVTIAFNFPFIYR"
     MSDLFLELNG KVHSLSETFP GLSVQEVSRQ SPQLSMETAE IAGTDGVIPG MTQFKPFIFS        60
     AKCNLQALDI PDYHLAVREI YEFLFQRDSY YIWSDQMPGI RYEVHPKPVD FSRESDRVGL       120
     LTIEFDVFKG YAESRGTSLD PMTFEVDLWQ MGMNLSNRDD LFYIFKENTF RVYNAGSDRV       180
     NPLMRHELDI AMTANGTPTI HNLTTGESFE YRKELQKTDV LLLNNIYPLV NNRRVGKDTN       240
     HGIITLEKGW NDFEIKGVTD VTIAFNFPFI YR                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page