(data stored in ACNUC10821 zone)

EMBL: AE017262.PE143

AE017262.PE143       Location/Qualifiers
FT   CDS             141451..141987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0172"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0145"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02933"
FT                   /protein_id="AAT02933.1"
FT                   /translation="MTKIVKMSEKNEHGTLEQFYPETHAEAVKGLVSVSEEEKATWNEK
FT                   ETTAGAEQKANTALNSAKDYVDTIGKGTVIFKGANIMAAGQKYTWNSSKLKFGITLLFS
FT                   RYDSANNTPLDYYYHSVFLSKAQLAELAGKGLLVPMPSATYGERKYLYVSETEVAGHND
FT                   NTNNASWALRQLTVM"
     MTKIVKMSEK NEHGTLEQFY PETHAEAVKG LVSVSEEEKA TWNEKETTAG AEQKANTALN        60
     SAKDYVDTIG KGTVIFKGAN IMAAGQKYTW NSSKLKFGIT LLFSRYDSAN NTPLDYYYHS       120
     VFLSKAQLAE LAGKGLLVPM PSATYGERKY LYVSETEVAG HNDNTNNASW ALRQLTVM         178
//

If you have problems or comments...

PBIL Back to PBIL home page