(data stored in ACNUC10821 zone)

EMBL: AE017262.PE144

AE017262.PE144       Location/Qualifiers
FT   CDS             142006..142428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0146"
FT                   /product="putative prophage LambdaLm01, holin"
FT                   /note="identified by match to protein family HMM PF05105;
FT                   match to protein family HMM TIGR01593"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0146"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02934"
FT                   /protein_id="AAT02934.1"
FT                   /translation="MEVILKIGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDSKSGDEEEKHDKDMD"
     MEVILKIGIL GFGAIFGYLF GEVDLLVKVL VCFIVADYIS GLLASGYLGE LSSKMGFKGI        60
     AKKIAILILV AIAHQIDLIL GTHNTTRDAV IFFYLANELI SILENFVRMG MKVPEVLKNL       120
     ILIFDSKSGD EEEKHDKDMD                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page