(data stored in ACNUC10821 zone)

EMBL: AE017262.PE148

AE017262.PE148       Location/Qualifiers
FT   CDS             complement(146536..148044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0150"
FT                   /product="putative inosine-5'-monophosphate dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02938"
FT                   /protein_id="AAT02938.1"
FT                   /translation="MAFYFEEPSRTFSEFLLVPGYSSAECVPTNVSLKTPIVKFKKGEE
FT                   SAITMNIPLVSAIMQAVSDDNMGIALATEGGVSFIFGSQSIESEAAMVSRVKNHKAGFV
FT                   ISDSNISPDKTLQDILNLKEKTGHSTVAVTEDGTAHGKLLGIVTSRDYRVTRMSPDEKV
FT                   ADFMTPFEKLVTANKSTTLKEANNIIWDNKLNALPLVDDNEHLVHMVFRKDYDSNKENK
FT                   LELLDSSKRYVVGAGINTRDYEERVPALVEAGADILCIDSSEGYSEWQKRTLDYVRGKY
FT                   GDTVKVGAGNVVDRDGFRYLAEAGADFVKVGVGGGSICITREQKGIGRGQATALIDVAK
FT                   ARDEYFEETGVYIPICSDGGIVYDYHMTLALAMGADFIMLGRYFSRFDESPTNKVNLNG
FT                   TYMKEYWGEGANRARNWQRYDLGGDKKLSFEEGVDSYVPYAGSLKDNVAISLSKVRSTM
FT                   CNCGALNIPELQQKAKITLVSSTSIVEGGAHDVVVKDASNNLIK"
     MAFYFEEPSR TFSEFLLVPG YSSAECVPTN VSLKTPIVKF KKGEESAITM NIPLVSAIMQ        60
     AVSDDNMGIA LATEGGVSFI FGSQSIESEA AMVSRVKNHK AGFVISDSNI SPDKTLQDIL       120
     NLKEKTGHST VAVTEDGTAH GKLLGIVTSR DYRVTRMSPD EKVADFMTPF EKLVTANKST       180
     TLKEANNIIW DNKLNALPLV DDNEHLVHMV FRKDYDSNKE NKLELLDSSK RYVVGAGINT       240
     RDYEERVPAL VEAGADILCI DSSEGYSEWQ KRTLDYVRGK YGDTVKVGAG NVVDRDGFRY       300
     LAEAGADFVK VGVGGGSICI TREQKGIGRG QATALIDVAK ARDEYFEETG VYIPICSDGG       360
     IVYDYHMTLA LAMGADFIML GRYFSRFDES PTNKVNLNGT YMKEYWGEGA NRARNWQRYD       420
     LGGDKKLSFE EGVDSYVPYA GSLKDNVAIS LSKVRSTMCN CGALNIPELQ QKAKITLVSS       480
     TSIVEGGAHD VVVKDASNNL IK                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page