(data stored in ACNUC10821 zone)

EMBL: AE017262.PE150

AE017262.PE150       Location/Qualifiers
FT   CDS             148456..148734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0152"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0152"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02940"
FT                   /protein_id="AAT02940.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKTEGKKIVPLCPFAKAEFAKKPEYQEVQAAK"
     MEYKNGENRI YAVNDEGVEV GEVTFVPTGE DMFIIDHTGV DDAARGQGIA QELVKRAVEK        60
     AKTEGKKIVP LCPFAKAEFA KKPEYQEVQA AK                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page