(data stored in ACNUC10821 zone)

EMBL: AE017262.PE151

AE017262.PE151       Location/Qualifiers
FT   CDS             149060..150634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0153"
FT                   /product="oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /note="identified by similarity to SP:P42061; match to
FT                   protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0153"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02941"
FT                   /protein_id="AAT02941.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSLIIG
FT                   VTGDPEVINPNYASDRVTLTIQQAVYAPLFWEVDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVNSILDTKQNSPNRGNFVFDDKPVKVEAVDDTTVKFTLPTVA
FT                   PAFENTIKTFFPIPKHIFEGVENIEKSDKNKNPIGSGPYKFVEYKTGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YATFNENQPALKSKELRQALSYALDREEIIDAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKKLVKESGFDTSQKLTVYYLNNSKSQESIALYLQQQYKEIGVTLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLYLSDAPYNYSNYHNKDLDALWEKG
FT                   AVTADDKERQEIYEKIQNTIADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
     MKKFLLVAVI SVFALVLTAC GGSGASSDKA NGSGKAKDGG SLIIGVTGDP EVINPNYASD        60
     RVTLTIQQAV YAPLFWEVDG KPALAKSLDI SDDNLTYTVK LKDGLTWHDG KPLTADDVVF       120
     TVNSILDTKQ NSPNRGNFVF DDKPVKVEAV DDTTVKFTLP TVAPAFENTI KTFFPIPKHI       180
     FEGVENIEKS DKNKNPIGSG PYKFVEYKTG EYVSLERFND YFDGKPKLDK VTFRITKDQN       240
     AANLALQNGE INLKSIQPSD RNKVEKASAV NIITYPENRL SYATFNENQP ALKSKELRQA       300
     LSYALDREEI IDAAYGSDEY AKPASSFLTE NTKYFTDKVE TYDQDIAKAK KLVKESGFDT       360
     SQKLTVYYLN NSKSQESIAL YLQQQYKEIG VTLDLKPTDP NALSNITLDR KNADYSIALN       420
     GYIMGNDPDA YKSLYLSDAP YNYSNYHNKD LDALWEKGAV TADDKERQEI YEKIQNTIAD       480
     DAVIYPISYD NAVLALDSRY GGQKAATPQP VTMFRDLSKL YLTE                        524
//

If you have problems or comments...

PBIL Back to PBIL home page