(data stored in ACNUC10821 zone)

EMBL: AE017262.PE153

AE017262.PE153       Location/Qualifiers
FT   CDS             151697..152590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0155"
FT                   /product="oligopeptide ABC transporter, permease protein"
FT                   /note="identified by similarity to SP:P42063; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0155"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02943"
FT                   /protein_id="AAT02943.1"
FT                   /translation="MRLDFSKKTMQDFERDAEVVHATRERSFWRFMLADRRAVFATSVL
FT                   ILITVACIFAFLSPYDPNALSVQDKLMPPNSSHWFGTDDHGRDYLTRVLYGGRVSLLVG
FT                   VFAMMIAVVVGTLAGTVSGYFGGFIDNMVMRFLDIFMSIPSFFLLMILNAYLKPGISNI
FT                   IIIIGLLSWMEVARIVRAETLTLKEREFILYSKSSGGGFFHIMFKHIIPNAMPSIVVAA
FT                   SLNVATAILTESALSFLGLGVQQPNASWGSMLNNAQGYVGEATYLALFPGLLILMTILS
FT                   FNVLGDVLRKGLSRRY"
     MRLDFSKKTM QDFERDAEVV HATRERSFWR FMLADRRAVF ATSVLILITV ACIFAFLSPY        60
     DPNALSVQDK LMPPNSSHWF GTDDHGRDYL TRVLYGGRVS LLVGVFAMMI AVVVGTLAGT       120
     VSGYFGGFID NMVMRFLDIF MSIPSFFLLM ILNAYLKPGI SNIIIIIGLL SWMEVARIVR       180
     AETLTLKERE FILYSKSSGG GFFHIMFKHI IPNAMPSIVV AASLNVATAI LTESALSFLG       240
     LGVQQPNASW GSMLNNAQGY VGEATYLALF PGLLILMTIL SFNVLGDVLR KGLSRRY          297
//

If you have problems or comments...

PBIL Back to PBIL home page