(data stored in ACNUC10821 zone)

EMBL: AE017262.PE155

AE017262.PE155       Location/Qualifiers
FT   CDS             153075..153443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="LMOf2365_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to OMNI:NTL01LI0184"
FT                   /db_xref="EnsemblGenomes-Gn:LMOf2365_0157"
FT                   /db_xref="EnsemblGenomes-Tr:AAT02945"
FT                   /protein_id="AAT02945.1"
FT                   /translation="MDAKSQQMETQLQLLKKEQSAAEDFLQDLQRQQNEQEWLAEDFAR
FT                   VHQEERESLELLREVWQGAESRSFGYYLADLQEEEKQKWHKKIQANQEEHQQKITACQN
FT                   NIYQLENQQQDLQKELLQ"
     MDAKSQQMET QLQLLKKEQS AAEDFLQDLQ RQQNEQEWLA EDFARVHQEE RESLELLREV        60
     WQGAESRSFG YYLADLQEEE KQKWHKKIQA NQEEHQQKIT ACQNNIYQLE NQQQDLQKEL       120
     LQ                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page